PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G65360.1
Common NameAGL23, T8F5.14
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family M-type_MADS
Protein Properties Length: 226aa    MW: 25336.9 Da    PI: 9.6685
Description AGAMOUS-like 23
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G65360.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF68.56.4e-221962649
                 HHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
       SRF-TF  6 ksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                 +sn qvtfskR++g++KKA+E ++LCda++a+i+fs+ gk++ +
  AT1G65360.1 19 ESNLQVTFSKRKAGLFKKASEFCTLCDAKIAMIVFSPAGKVFSF 62
                 7899*************************************988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.3E-31665IPR002100Transcription factor, MADS-box
PROSITE profilePS5006624.095666IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.22E-25789IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-18828IPR002100Transcription factor, MADS-box
PfamPF003191.1E-231662IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-182843IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-184364IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009553Biological Processembryo sac development
GO:0009658Biological Processchloroplast organization
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009032anatomypetal
PO:0009089anatomyendosperm
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020090anatomyembryo sac central cell
PO:0020100anatomyhypocotyl
PO:0025074anatomyembryo sac
PO:0001054developmental stagevascular leaf senescent stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MVKKTLGRRK VEIVKMTKES NLQVTFSKRK AGLFKKASEF CTLCDAKIAM IVFSPAGKVF  60
SFGHPNVDVL LDHFRGCVVG HNNTNLDESY TKLHVQMLNK SYTEVKAEVE KEQKNKQSRA  120
QNERENENAE EWWSKSPLEL NLSQSTCMIR VLKDLKKIVD EKAIQLIHQT NPNFYVGSSS  180
NAAAPATVSG GNISTNQGFF DQNGMTTNPT QTLLFGFDIM NRTPGV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A2e-15773168Myocyte-specific enhancer factor 2A
3kov_B2e-15773168Myocyte-specific enhancer factor 2A
3kov_I2e-15773168Myocyte-specific enhancer factor 2A
3kov_J2e-15773168Myocyte-specific enhancer factor 2A
3p57_A2e-15773168Myocyte-specific enhancer factor 2A
3p57_B2e-15773168Myocyte-specific enhancer factor 2A
3p57_C2e-15773168Myocyte-specific enhancer factor 2A
3p57_D2e-15773168Myocyte-specific enhancer factor 2A
3p57_I2e-15773168Myocyte-specific enhancer factor 2A
3p57_J2e-15773168Myocyte-specific enhancer factor 2A
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO184082630.0
Genevisible264182_at0.0
Expression AtlasAT1G65360-
AtGenExpressAT1G65360-
ATTED-IIAT1G65360-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: During embryo development, expressed in the functional megaspore until maturity of the embryo sac. After fertilization, expressed in the embryo and endosperm until the early torpedo stage. Not expressed in mature embryo. {ECO:0000269|PubMed:18346189}.
Functional Description ? help Back to Top
Source Description
TAIREncodes AGL23, a Type I MADS-box gene that controls female gametophyte development and the biogenesis of organelles during embryo development.
UniProtProbable transcription factor that controls female gametophyte (megagametogenesis) development and chloroplast biogenesis during embryo development. {ECO:0000269|PubMed:18346189}.
Function -- GeneRIF ? help Back to Top
  1. AGL23 is involved in controlling the biogenesis of chloroplasts during embryo development.
    [PMID: 18346189]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G65360.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
IntActSearch O80807
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Embryonic lethality when homozygous. {ECO:0000269|PubMed:18346189}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G65360
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1412300.0AY141230.1 Arabidopsis thaliana MADS-box protein AGL23 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_176715.11e-170protein agamous-like 23
SwissprotO808071e-172AGL23_ARATH; Agamous-like MADS-box protein AGL23
TrEMBLQ84VN11e-123Q84VN1_ARATH; Putative MADS-box transcription factor (Fragment)
STRINGAT1G65360.11e-170(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17507710
Representative plantOGRP1617761
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Shepard KA,Purugganan MD
    Molecular population genetics of the Arabidopsis CLAVATA2 region. The genomic scale of variation and selection in a selfing species.
    Genetics, 2003. 163(3): p. 1083-95
    [PMID:12663546]
  3. De Bodt S, et al.
    Genomewide structural annotation and evolutionary analysis of the type I MADS-box genes in plants.
    J. Mol. Evol., 2003. 56(5): p. 573-86
    [PMID:12698294]
  4. Parenicov√° L, et al.
    Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world.
    Plant Cell, 2003. 15(7): p. 1538-51
    [PMID:12837945]
  5. Kofuji R, et al.
    Evolution and divergence of the MADS-box gene family based on genome-wide expression analyses.
    Mol. Biol. Evol., 2003. 20(12): p. 1963-77
    [PMID:12949148]
  6. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  7. de Folter S, et al.
    Comprehensive interaction map of the Arabidopsis MADS Box transcription factors.
    Plant Cell, 2005. 17(5): p. 1424-33
    [PMID:15805477]
  8. Pina C,Pinto F,Feij
    Gene family analysis of the Arabidopsis pollen transcriptome reveals biological implications for cell growth, division control, and gene expression regulation.
    Plant Physiol., 2005. 138(2): p. 744-56
    [PMID:15908605]
  9. Colombo M, et al.
    AGL23, a type I MADS-box gene that controls female gametophyte and embryo development in Arabidopsis.
    Plant J., 2008. 54(6): p. 1037-48
    [PMID:18346189]
  10. Day RC,Herridge RP,Ambrose BA,Macknight RC
    Transcriptome analysis of proliferating Arabidopsis endosperm reveals biological implications for the control of syncytial division, cytokinin signaling, and gene expression regulation.
    Plant Physiol., 2008. 148(4): p. 1964-84
    [PMID:18923020]
  11. Bemer M,Heijmans K,Airoldi C,Davies B,Angenent GC
    An atlas of type I MADS box gene expression during female gametophyte and seed development in Arabidopsis.
    Plant Physiol., 2010. 154(1): p. 287-300
    [PMID:20631316]
  12. Tamura K,Fukao Y,Iwamoto M,Haraguchi T,Hara-Nishimura I
    Identification and characterization of nuclear pore complex components in Arabidopsis thaliana.
    Plant Cell, 2010. 22(12): p. 4084-97
    [PMID:21189294]
  13. Willmann MR,Mehalick AJ,Packer RL,Jenik PD
    MicroRNAs regulate the timing of embryo maturation in Arabidopsis.
    Plant Physiol., 2011. 155(4): p. 1871-84
    [PMID:21330492]